Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHMP2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191781
Description
CHMP2A Polyclonal specifically detects CHMP2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CHMP2A | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
BC-2, BC2VPS2 homolog A, CHMP2a, CHMP2hVps2-1, chromatin modifying protein 2A, Chromatin-modifying protein 2a, Putative breast adenocarcinoma marker BC-2, Vacuolar protein sorting-associated protein 2-1, vps2-1, VPS2Aputative breast adenocarcinoma marker (32kD), VPS2charged multivesicular body protein 2a | |
Rabbit | |
Affinity Purified | |
RUO | |
27243 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CHMP2A | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRA | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction