Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

CHRND, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CHRND.

Manufacturer:  Abnova Corporation H00001144A01

Catalog No. 89-003-249



Description

Description

The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [provided by RefSeq

Sequence: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN
Specifications

Specifications

CHRND
Unconjugated
50% glycerol
NM_000751
ACHRD|CMS2A|FCCMS|SCCMS
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CHRND.
CHRND
Liquid
CHRND
CHRND (NP_000742, 24 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
RUO
Primary
1144
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit