cytokine induced apoptosis inhibitor 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CIAPIN1 protein.

Supplier:  Abnova Corporation H00057019D01P

Catalog No. 89-018-546

Description

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM

Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA

Specifications

• Antigen: cytokine induced apoptosis inhibitor 1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CIAPIN1 protein.
• Gene: CIAPIN1
• Gene Alias: 2810413N20Rik/Anamorsin/DRE2/PRO0915
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020313.2
• Gene Symbols: CIAPIN1
• Immunogen: CIAPIN1 (NP_064709.2, 1 a.a. ∼ 312 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 57019
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG