Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

creatine kinase, muscle, Mouse, Clone: 3E1-F3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CKM.

Manufacturer:  Abnova Corporation H00001158M01

Catalog No. 89-000-576


  Check Availability
Add to cart

Specifications

Description

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq

Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Description & Specifications

Specifications

creatine kinase, muscle
3E1-F3
creatine kinase, muscle
CKM
Affinity Purified
CKM
CKM (AAH07462, 1 a.a. ∽382 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A column
RUO
Y
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In 1X PBS, pH 7.4
BC007462
CKMM, M-CK
Murine
IgG1
100μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1158
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit