CLCN7, Mouse, Clone: 4A3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLCN7.

Manufacturer: Abnova Corporation H00001186M01A

Catalog No. 89-021-106

  Check Availability
Add to Cart

    Specifications

    Antigen CLCN7
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 4A3
    Conjugate Unlabeled
    Cross Reactivity Human
    Description chloride channel 7
    Format Ascites
    Formulation In ascites fluid
    Gene CLCN7
    Gene Accession No. NM_001287
    Gene Alias CLC-7, CLC7, FLJ26686, FLJ39644, FLJ46423, OPTA2, OPTB4
    Gene Symbols CLCN7
    Host Species Mouse
    Immunogen CLCN7 (NP_001278, 706 a.a. ∽806 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1186

    The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. [provided by RefSeq

    Sequence: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit