Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chloride channel 7, Mouse, Clone: 4A3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLCN7.

Manufacturer:  Abnova Corporation H00001186M01

Catalog No. 89-000-578


  Check Availability
Add to cart

Specifications

Description

The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. [provided by RefSeq

Sequence: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT
Description & Specifications

Specifications

chloride channel 7
4A3
Human
Affinity Purified
CLCN7
CLC-7, CLC7, FLJ26686, FLJ39644, FLJ46423, OPTA2, OPTB4
Murine
IgG2a
50μg
Human
Y
Monoclonal
Human
ELISA,Western Blot
Unlabeled
chloride channel 7
In 1X PBS, pH 7.4
NM_001287
CLCN7
CLCN7 (NP_001278, 706 a.a. ∽806 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1186
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit