Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLIC5 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180077

Catalog No. NBP180077


Add to cart

Description

Description

CLIC5 Polyclonal antibody specifically detects CLIC5 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

CLIC5
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
CLIC5
Synthetic peptide directed towards the C terminal of human CLIC5. Peptide sequence YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS.
Protein A purified
RUO
Primary
53405
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_058625
chloride intracellular channel 5, chloride intracellular channel 5A, chloride intracellular channel protein 5, CLIC5B, dJ447E21.4, FLJ90663, MST130, MSTP130
Rabbit
IgG
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Xenopus: 92%; Canine: 92%; Mouse: 92%; Rat: 92%; Chicken: 91%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only