Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

collagen, type IV, alpha 3 (Goodpasture antigen) binding protein, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant COL4A3BP.

Manufacturer:  Abnova Corporation H00010087A01

Catalog No. 89-004-468


Add to cart

Description

Description

This gene encodes a kinase that specifically phosphorylates the N-terminal region of the noncollagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: TWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Specifications

Specifications

collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
Unconjugated
50% glycerol
NM_031361
CERT|CERTL|FLJ20597|GPBP|STARD11
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10087
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant COL4A3BP.
COL4A3BP
Serum
COL4A3BP
COL4A3BP (NP_112729, 499 a.a. ~ 598 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit