Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-COX4NB, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP213864

Catalog No. NBP213864

Add to cart



COX4NB Polyclonal specifically detects COX4NB in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.


PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
C16orf2, C16orf4, chromosome 16 open reading frame 2, COX4 neighbor, COX4AL, FAM158Bchromosome 16 open reading frame 4, neighbor of COX4, NOC4family with sequence similarity 158, member B, Protein FAM158B
0.1 ml
Core ESC Like Genes, Stem Cell Markers
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTL FVD
Immunogen affinity purified
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only