COX6B1, Mouse, Clone: 5D3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant COX6B1.

Manufacturer: Abnova Corporation H00001340M01

Catalog No. 89-021-138

  Check Availability
Add to Cart

    Specifications

    Antigen COX6B1
    Applications Enzyme Linked Immunosorbent Assay,Immunohistochemistry,Western Blotting
    Clone 5D3
    Conjugate Unlabeled
    Cross Reactivity Human
    Description cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene COX6B1
    Gene Accession No. NM_001863
    Gene Alias COX6B, COXG
    Gene Symbols COX6B1
    Host Species Mouse
    Immunogen COX6B1 (NP_001854, 1 a.a. ∽87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG1, κ
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1340

    Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq

    Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit