Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COX6B1, Mouse, Clone: 5D3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant COX6B1.

Manufacturer:  Abnova Corporation H00001340M01

Catalog No. 89-021-138


  Check Availability
Add to cart

Specifications

Description

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq

Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Description & Specifications

Specifications

COX6B1
5D3
Human
Liquid
COX6B1
COX6B, COXG
Murine
IgG1, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Immunohistochemistry,Western Blot
Unlabeled
cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
In 1X PBS, pH 7.4
NM_001863
COX6B1
COX6B1 (NP_001854, 1 a.a. ∽87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
50μg
Human
Primary
1340
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit