Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cAMP responsive element modulator, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CREM protein.

Manufacturer:  Abnova Corporation H00001390B01

Catalog No. 89-005-172


Add to cart

Description

Description

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq

Sequence: MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Specifications

Specifications

cAMP responsive element modulator
Unconjugated
No additive
NM_001881.2
ICER|MGC111110|MGC17881|MGC41893|hCREM-2
Mouse
50 uL
Transcription Regulation
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human CREM protein.
CREM
Serum
CREM
CREM (NP_001872.3, 1 a.a. ~ 137 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1390
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit