Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

chondroitin sulfate proteoglycan 5 (neuroglycan C), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CSPG5.

Manufacturer:  Abnova Corporation H00010675A01

Catalog No. 89-004-506


Add to cart

Description

Description

Sequence: KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Specifications

Specifications

chondroitin sulfate proteoglycan 5 (neuroglycan C)
Unconjugated
50% glycerol
NM_006574
MGC44034|NGC
Mouse
50 uL
Neurobiology
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CSPG5.
CSPG5
Serum
CSPG5
CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10675
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit