cysteine and glycine-rich protein 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CSRP1.

Supplier:  Abnova Corporation H00001465A01

Catalog No. 89-004-084

Description

This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. [provided by RefSeq

Sequence: EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS

Specifications

• Antigen: cysteine and glycine-rich protein 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CSRP1.
• Gene: CSRP1
• Gene Alias: CRP/CRP1/CSRP/CYRP/D1S181E/DKFZp686M148
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 1465
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004078
• Gene Symbols: CSRP1
• Immunogen: CSRP1 (NP_004069, 94 a.a. ∼ 192 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum