Cullin 1, Polyclonal, Invitrogen™

Catalog No.	Quantity
PIPA124260	100 μg

Catalog No. PIPA124260

Supplier: Thermo Scientific PA124260

Description

Rabbit Polyclonal Antibody

Cullin 1 is a member of the family of human cullin genes (CUL 1, 2, 3, 4a, 4b, and 5) homologous to the S. cerevisiae cdc 53 gene. CUL 1 forms a complex with human p19 skp1 and F box protein p45 skp2, both of which, together with cdc 53 (known as CUL A), as three subunits form a ubiquitin ligase controlling proteolysis of G1 cell cycle regulatory proteins. The CUL 1/p19 skp1/p45 skp2complex is thought to play a role in the ubiquitination of G1 regulatory proteins.

PA1-24260 detects Cullin 1 (CUL-1) in human samples.PA1-24260 has been successfully used in Western blot procedures.The PA1-24260 immunogen is a synthetic peptide corresponding to residues HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA of human CUL1.

Specifications

• Antigen: Cullin 1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 1mg/mL
• Conjugate: Unconjugated
• Gene: CUL1
• Gene Accession No.: Q13616
• Gene Alias: CUL-1
• Gene Symbols: CUL1
• Host Species: Rabbit
• Immunogen: Synthetic peptide corresponding to residues HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA of human CUL1.
• Purification Method: Protein A/G
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8454
• Target Species: Human
• Content And Storage: Store at -20°C, Avoid Freeze/Thaw Cycles
• Product Type: Antibody
• Form: Purified
• Isotype: IgG