Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CXCL12 Rabbit anti-Mouse, Rat, Polyclonal, Invitrogen™

Rabbit Polyclonal Antibody

Manufacturer:  Invitrogen PA129029

Catalog No. PA129029


Add to cart

Description

Description

PA1-29029 detects CXCL12 from rat and mouse samples. PA1-29029 has been successfully used in immunohistochemistry, immunoprecipitation and Western blot applications. The PA1-29029 immunogen is a recombit protein generated using E. coli-expressed mouse SDF-1 alpha. The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK. Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4°C. For long-term storage, aliquot and store at -20° C or below, avoiding multiple freeze-thaw cycles.

The protein encoded by this gene is a member of the intercrine-macrophage inflammatory protein superfamily. It is a secreted protein thought to be involved in the generation and proliferation of early B-cell progenitors. Three transcript variants encoding three different isoforms have been found for this gene.
Specifications

Specifications

CXCL12
Polyclonal
Unconjugated
Cxcl12
Liquid
CXCL12
Recombit protein was generated using E coli-expressed mouse SDF-1alpha as an immunogen. The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK.
Protein A
RUO
Antibody
Polyclonal
Mouse, Rat
Immunohistochemistry, Immunoprecipitation, Western Blot
1 mg/mL
PBS with 0.1% sodium azide; pH 7.2
P40224
AI174028, Pbsf, Scyb12, Sdf1, Sdf1a, Sdf1b, Tlsf, Tlsfa, Tlsfb, Tpar1
Rabbit
IgG
100 μg
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Primary
20315, 24772
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit