Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
XCR1/CCXCR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP188143
Description
XCR1/CCXCR1 Polyclonal specifically detects XCR1/CCXCR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
XCR1/CCXCR1 | |
Polyclonal | |
Unconjugated | |
PBS (pH 7.2) and 40% glycerol with 0.02% Sodium Azide | |
CCXCR1XC chemokine receptor 1, chemokine (C motif) receptor 1, chemokine XC receptor 1, G protein-coupled receptor 5, GPR5chemokine (C motif) XC receptor 1, G-protein coupled receptor 5, Lymphotactin receptor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.05mg/mL | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 | |
P25024 | |
XCR1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MESSGNPESTTFFYYDLQSQPCENQAWVFATLA | |
0.1 mL | |
Chemokines and Cytokines | |
2829 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction