CXCR4 (M02), Mouse anti-Human, Clone: 1F8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CXCR4.

Supplier:  Abnova Corporation H00007852M02

Catalog No. 89-002-725

Description

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Specifications

• Antigen: CXCR4,
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC020968
• Gene Symbols: CXCR4
• Immunogen: CXCR4 (AAH20968, 1 a.a. ∼ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 1F8
• Description: Mouse monoclonal antibody raised against a partial recombinant CXCR4.
• Gene: CXCR4
• Gene Alias: CD184/D2S201E/FB22/HM89/HSY3RR/LAP3/LCR1/LESTR/NPY3R/NPYR/NPYRL/NPYY3R/WHIM
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 7852
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid