Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-CYP11A1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154758

Catalog No. NBP154758


Add to cart

Description

Description

CYP11A1 Polyclonal antibody specifically detects CYP11A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

CYP11A1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CYP11A1
Synthetic peptides corresponding to CYP11A1(cytochrome P450, family 11, subfamily A, polypeptide 1) The peptide sequence was selected from the N terminal of CYP11A1. Peptide sequence QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL.
57 kDa
100 ul
Lipid and Metabolism
Primary
1583
Human
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P05108
Cholesterol desmolase, cholesterol monooxygenase (side-chain-cleaving), cholesterol side-chain cleavage enzyme, mitochondrial, CYPXIA1, Cytochrome P450 11A1, Cytochrome P450(scc), cytochrome P450, family 11, subfamily A, polypeptide 1, cytochrome P450C11A1, EC 1.14.15, EC 1.14.15.6, steroid 20-22-lyase, subfamily XIA (cholesterol side chain cleavage)
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only