Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYTB Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179340

Catalog No. NBP179340


Add to cart

Description

Description

CYTB Polyclonal antibody specifically detects CYTB in Human, Mouse, Rat samples. It is validated for Western Blot.
Specifications

Specifications

CYTB
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CYTB
Synthetic peptide directed towards the N terminal of human CYTB. Peptide sequence TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL.
Immunogen affinity purified
RUO
Primary
4519
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NC_012920
cytochrome b, MTCYB, MT-CYB mitochondrially encoded cytochrome b
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Sigmodon hispidus texianus: 100%; Lesser tufted-tailed rat: 100%; collared tuco-tuco: 100%; Spiked Atlantic spiny rat: 100%; Soft-spined Atlantic spiny rat: 100%; Tanala tufted-tailed rat: 100%; Abrothrix olivaceus canescens: 100%; European pine vole: 100%; Dormouse tufted-tailed rat: 100%; Webb's tufted-tailed rat: 100%; Abrothrix olivaceus beatus: 100%; Spermophilus mexicanus parvidens: 100%; Glaucomys sabrinus yukonensis: 100%; Trinomys sp. ML110: 100%; Glaucomys sabrinus oregonensis: 100%; Glaucomys sabrinus fuliginosus: 100%; Glaucomys volans volans: 100%; Juscelinomys huanchacae: 100%; elegant rice rat: 100%; Macconnell's rice rat: 100%; Euryoryzomys emmonsae: 100%; Yungas rice rat: 100%; Large-headed rice rat: 100%; Pleasant bolo mouse: 100%; Ctenomys dorbignyi: 100%; Rock karroo rat: 100%; West African shaggy rat: 100%; Yellow-necked field mouse: 100%; Glaucomys sabrinus sabrinus: 100%; Betsileo short-tailed rat: 100%; Trinomys sp. EDH33: 100%; Rio de Janeiro spiny rat: 100%; Golden hamster: 100%; marsh rat: 100%; striped Atlantic forest rat: 100%; Long-tailed climbing mouse: 100%; Rhipidomys sp. 2: 100%; splendid climbing mouse: 100%; Pearsonomys annectens: 100%; swamp rat: 100%.
Human, Mouse, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only