2,4-dienoyl CoA reductase 2, peroxisomal, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human DECR2 protein.

Manufacturer: Abnova Corporation H00026063D01P

Catalog No. 89-018-122

  Check Availability
Add to Cart

    Specifications

    Antigen 2,4-dienoyl CoA reductase 2, peroxisomal
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description 2,4-dienoyl CoA reductase 2, peroxisomal
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene DECR2
    Gene Accession No. NM_020664
    Gene Alias PDCR, SDR17C1
    Gene Symbols DECR2
    Host Species Rabbit
    Immunogen DECR2 (NP_065715.1, 1 a.a. ∽292 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Research Discipline Endocrine/Metabolism
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 26063

    Sequence: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit