Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

dehydrogenase/reductase (SDR family) X-linked, Mouse, Polyclonal Antibody, Abnova™

Name: dehydrogenase/reductase (SDR family) X-linked, Mouse, Polyclonal Antibody, Abnova&#153;
SKU: 89-008-677
Price: 399.00 USD

Mouse polyclonal antibody raised against a full-length human DHRSX protein.

Manufacturer: Abnova Corporation H00207063B01

Catalog No. 89-008-677

$399.00 / Each

Qty

Add to cart

Description

Sequence: MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL

Specifications

Antigen	dehydrogenase/reductase (SDR family) X-linked
Conjugate	Unconjugated
Formulation	No additive
Gene Accession No.	NM_145177.1
Gene Alias	CXorf11\|DHRS5X\|DHRS5Y\|DHRSXY\|DHRSY\|SDR46C1
Host Species	Mouse
Quantity	50 uL
Research Discipline	Endocrine/Metabolism
Whole Molecule	Y
Monoclonal or Polyclonal	Polyclonal
Target Species	Human

Applications	Immunofluorescence, Western Blot
Description	Mouse polyclonal antibody raised against a full-length human DHRSX protein.
Gene	DHRSX
Format	Serum
Gene Symbols	DHRSX
Immunogen	DHRSX (NP_660160.1, 1 a.a. ~ 330 a.a) full-length human protein.
Regulatory Status	RUO
Storage Requirements	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary or Secondary	Primary
Gene ID (Entrez)	207063

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Provide Content Correction