dicer 1, ribonuclease type III, Mouse, Clone: 2F12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DICER1.

Supplier:  Abnova Corporation H00023405M01

Catalog No. 89-014-286

Description

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq

Sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL

Specifications

• Antigen: dicer 1, ribonuclease type III
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_177438
• Gene Symbols: DICER1
• Immunogen: DICER1 (NP_803187, 1813 a.a. ∼ 1912 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Research Discipline: Angiogenesis
• Gene ID (Entrez): 23405
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 2F12
• Description: Mouse monoclonal antibody raised against a partial recombinant DICER1.
• Gene: DICER1
• Gene Alias: DCR1/Dicer/HERNA/KIAA0928
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody