Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DPM1.

Manufacturer:  Abnova Corporation H00008813A01

Catalog No. 89-004-406


Add to cart

Description

Description

Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. [provided by RefSeq

Sequence: RKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT
Specifications

Specifications

dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
Unconjugated
50% glycerol
NM_003859
CDGIE|MPDS
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8813
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant DPM1.
DPM1
Serum
DPM1
DPM1 (NP_003850, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit