DPYSL5, Mouse, Clone: 2G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DPYSL5.

Supplier:  Abnova Corporation H00056896M02

Catalog No. 89-002-641

Description

Members of the CRMP family, such as DPYSL5, are believed to play a role in growth cone guidance during neural development.[supplied by OMIM

Sequence: SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW

Specifications

• Antigen: DPYSL5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020134
• Gene Symbols: DPYSL5
• Immunogen: DPYSL5 (NP_064519, 466 a.a. ∼ 564 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 2G4
• Description: Mouse monoclonal antibody raised against a partial recombinant DPYSL5.
• Gene: DPYSL5
• Gene Alias: CRAM/CRMP-5/CRMP5/FLJ45383/Ulip6
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 56896
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid