Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DPYSL5, Mouse, Clone: 2G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DPYSL5.

Manufacturer:  Abnova Corporation H00056896M02

Catalog No. 89-002-641


Add to cart

Description

Description

Members of the CRMP family, such as DPYSL5, are believed to play a role in growth cone guidance during neural development.[supplied by OMIM

Sequence: SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW
Specifications

Specifications

DPYSL5
2G4
Mouse monoclonal antibody raised against a partial recombinant DPYSL5.
DPYSL5
Liquid
DPYSL5
DPYSL5 (NP_064519, 466 a.a. ~ 564 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_020134
CRAM|CRMP-5|CRMP5|FLJ45383|Ulip6
Mouse
IgG2b Kappa
RUO
Primary
56896
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit