Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dynein light chain 2 cytoplasmic Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154377
Description
Dynein light chain 2 cytoplasmic Polyclonal specifically detects Dynein light chain 2 cytoplasmic in Human samples. It is validated for Western Blot.Specifications
Dynein light chain 2 cytoplasmic | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DLC2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22 | |
Rabbit | |
10 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96FJ2 | |
DYNLL2 | |
Synthetic peptides corresponding toDynein light chain 2 cytoplasmic(dynein, light chain, LC8-type 2) The peptide sequence was selected from the N terminal of Dynein light chain 2 cytoplasmic. Peptide sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY. | |
Affinity purified | |
RUO | |
140735 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction