Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dynein light chain 2 cytoplasmic Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154377

Catalog No. NBP154377


Add to cart

Description

Description

Dynein light chain 2 cytoplasmic Polyclonal antibody specifically detects Dynein light chain 2 cytoplasmic in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Dynein light chain 2 cytoplasmic
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
DYNLL2
Synthetic peptides corresponding toDynein light chain 2 cytoplasmic(dynein, light chain, LC8-type 2) The peptide sequence was selected from the N terminal of Dynein light chain 2 cytoplasmic. Peptide sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY.
10 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q96FJ2
DLC2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
140735
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only