Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 (A01), Mouse anti-Human, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DYRK4.

Manufacturer:  Abnova Corporation H00008798A01

Catalog No. 89-004-404


Add to cart

Description

Description

Dual-specificity kinases, such as DYRK4, play key roles in cell proliferation, survival, and development (Zhang et al., 2005 [PubMed 15607427]).[supplied by OMIM

Sequence: FFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
Specifications

Specifications

dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Unconjugated
50% glycerol
BC031244
DYRK4
DYRK4 (AAH31244, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8798
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant DYRK4.
DYRK4
Serum
Mouse
50 uL
Kinases
Y
Polyclonal
Human, Murine
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit