ectodysplasin A2 receptor, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human EDA2R protein.

Manufacturer:  Abnova Corporation H00060401B01

Catalog No. 89-008-029

Description

EDA-A1 and EDA-A2 are two isoforms of ectodysplasin that are encoded by the anhidrotic ectodermal dysplasia (EDA) gene. Mutations in EDA give rise to a clinical syndrome characterized by loss of hair, sweat glands, and teeth. The protein encoded by this gene specifically binds to EDA-A2 isoform. This protein is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. Multiple alternatively spliced transcript variants have been found for this gene, but some variants lack sufficient support. [provided by RefSeq

Sequence: MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP

Specifications

• Antigen: ectodysplasin A2 receptor
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human EDA2R protein.
• Gene: EDA2R
• Gene Alias: EDA-A2R/EDAA2R/TNFRSF27/XEDAR
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human

• Applications: Flow Cytometry, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_021783
• Gene Symbols: EDA2R
• Immunogen: EDA2R (NP_068555, 1 a.a. ∼ 297 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 60401
• Form: Serum