Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-EGLN3/PHD3, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP154943

Catalog No. NBP154943

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

EGLN3/PHD3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
EGLN3
Synthetic peptides corresponding to EGLN3(egl nine homolog 3 (C. elegans)) The peptide sequence was selected from the C terminal of EGLN3 (NP_071356). Peptide sequence FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT.
27 kDa
100 ul
Apoptosis, Cancer, Chromatin Research, Hypoxia
Primary
112399
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
Q9H6Z9
EC 1.14.11, EC 1.14.11.-, EGL nine (C.elegans) homolog 3, egl nine homolog 3, egl nine homolog 3 (C. elegans), egl nine-like protein 3 isoform, FLJ21620, HIF prolyl hydroxylase 3, HIF-PH3, HIFPH3 MGC125998, HIF-prolyl hydroxylase 3, HPH-1, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 3, MGC125999, pdh3, PHD3, Prolyl hydroxylase domain-containing protein 3
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Sheep: 77%; Zebrafish: 75%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only