Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-EIF3S3, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP184870

Catalog No. NBP184870


Add to cart

Description

Description

EIF3S3 Polyclonal antibody specifically detects EIF3S3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

EIF3S3
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
eIF-3-gamma, eIF3-gamma, eIF3h, eIF3-p40, EIF3S3eIF3 p40 subunit, Eukaryotic translation initiation factor 3 subunit 3, eukaryotic translation initiation factor 3 subunit H, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD), eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa, eukaryotic translation initiation factor 3, subunit H, MGC102958
Rabbit
IgG
0.1 ml
Angiogenesis, Cancer
Primary
8667
Human, Mouse, Rat
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Affinity Purified
EIF3H
This antibody was developed against Recombinant Protein corresponding to amino acids:QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only