Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

eukaryotic translation initiation factor 4E family member 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human EIF4E2 protein.

Manufacturer:  Abnova Corporation H00009470B01

Catalog No. 89-006-782


Add to cart

Description

Description

Sequence: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Specifications

Specifications

eukaryotic translation initiation factor 4E family member 2
Unconjugated
No additive
NM_004846.2
4E-LP|4EHP|EIF4EL3|IF4e
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
9470
Western Blot
Mouse polyclonal antibody raised against a full-length human EIF4E2 protein.
EIF4E2
Serum
EIF4E2
EIF4E2 (AAH21690.1, 1 a.a. ~ 245 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit