Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELAVL4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ELAVL4.

Manufacturer:  Abnova Corporation H00001996A01

Catalog No. 89-003-265


Add to cart

Description

Description

Sequence: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Specifications

Specifications

ELAVL4
Unconjugated
50% glycerol
NM_021952
HUD|PNEM
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ELAVL4.
ELAVL4
Liquid
ELAVL4
ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag.
RUO
Primary
1996
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit