Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

elongation factor RNA polymerase II-like 3 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Name: elongation factor RNA polymerase II-like 3 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova&trade;
Brand: Abnova Corporation
SKU: 89-008-237

Mouse polyclonal antibody raised against a full-length human ELL3 protein.

Supplier: Abnova Corporation H00080237B01

Catalog No. 89-008-237

Item Discontinued This item has been discontinued by the manufacturer and is no longer available. Please reach out to your sales representative.

Description

Sequence: MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS

Specifications

Antigen	elongation factor RNA polymerase II-like 3
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a full-length human ELL3 protein.
Gene	ELL3
Gene Alias	FLJ22637
Host Species	Mouse
Quantity	50 μL
Research Discipline	Transcription Regulation
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	Western Blot
Conjugate	Unconjugated
Formulation	No additive
Gene Accession No.	BC019293
Gene Symbols	ELL3
Immunogen	ELL3 (AAH19293, 1 a.a. ∼ 397 a.a) full-length human protein.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	80237
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Provide Content Correction

Welcome to fishersci.com

elongation factor RNA polymerase II-like 3 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Description

Specifications

Documents

Promotions