Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

elongation factor RNA polymerase II-like 3 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human ELL3 protein.

Manufacturer:  Abnova Corporation H00080237B01

Catalog No. 89-008-237


Add to cart

Description

Description

Sequence: MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
Specifications

Specifications

elongation factor RNA polymerase II-like 3
Polyclonal
Mouse polyclonal antibody raised against a full-length human ELL3 protein.
ELL3
FLJ22637
Mouse
50 μL
Transcription Regulation
Primary
Human
Serum
Western Blot
Unconjugated
No additive
BC019293
ELL3
ELL3 (AAH19293, 1 a.a. ∼ 397 a.a) full-length human protein.
RUO
Yes
80237
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit