ELOVL7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP193926

Catalog No. NBP193926

Description

ELOVL7 Polyclonal specifically detects ELOVL7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ELOVL7
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: ELOVL family member 7, elongation of long chain fatty acids, ELOVL fatty acid elongase 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human ELOVL7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ELOVL7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cardiovascular Biology, Cellular Signaling, metabolism
• Gene ID (Entrez): 79993
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only