excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ERCC3.

Supplier:  Abnova Corporation H00002071A01

Catalog No. 89-004-115

Description

ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription. [provided by RefSeq

Sequence: APGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVS

Specifications

• Antigen: excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ERCC3.
• Gene: ERCC3
• Gene Alias: BTF2/GTF2H/RAD25/TFIIH/XPB
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 2071
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC008820
• Gene Symbols: ERCC3
• Immunogen: ERCC3 (AAH08820, 29 a.a. ∼ 128 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum