Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ecotropic viral integration site 2A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human EVI2A protein.

Manufacturer:  Abnova Corporation H00002123B01

Catalog No. 89-005-324


Add to cart

Description

Description

Sequence: SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
Specifications

Specifications

ecotropic viral integration site 2A
Unconjugated
No additive
BC035572
EVDA|EVI2
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human
Flow Cytometry, Western Blot
Mouse polyclonal antibody raised against a full-length human EVI2A protein.
EVI2A
Serum
EVI2A
EVI2A (AAH35572, 25 a.a. ~ 236 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
2123
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit