Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FABP7, Mouse, MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FABP7 protein.

Manufacturer:  Abnova Corporation H00002173B02

Catalog No. 89-002-682


Add to cart

Description

Description

The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq

Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Specifications

Specifications

FABP7
Unconjugated
No additive
NM_001446
B-FABP|BLBP|DKFZp547J2313|FABPB|MRG
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human FABP7 protein.
FABP7
Liquid
FABP7
FABP7 (NP_001437.1, 1 a.a. ~ 132 a.a) full-length human protein.
RUO
Primary
2173
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit