Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM107A Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154335

Catalog No. NBP154335


Add to cart

Description

Description

FAM107A Polyclonal antibody specifically detects FAM107A in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

FAM107A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
FAM107A
Synthetic peptides corresponding to FAM107A(family with sequence similarity 107, member A) The peptide sequence was selected from the middle region of FAM107A. Peptide sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE.
17 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.0625 ug/ml
O95990
downregulated in renal cell carcinoma, DRR1family with sequence similarity 107 member A transcript, family with sequence similarity 107, member A, FLJ30158, FLJ45473, Protein TU3A, TU3ADown-regulated in renal cell carcinoma 1
Rabbit
IgG
Protein A purified
RUO
Primary
11170
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only