Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
anti-FAM206A, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP184529
Description
FAM206A Polyclonal antibody specifically detects FAM206A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
FAM206A | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CG-8, chromosome 9 open reading frame 6, FLJ20457, hypothetical protein LOC54942 | |
Rabbit | |
IgG | |
0.1 ml | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
Polyclonal | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Affinity Purified | |
FAM206A | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVS | |
Immunogen affinity purified | |
RUO | |
Primary | |
54942 | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only