Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FARP1, Mouse, Clone: 2D4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FARP1.

Manufacturer:  Abnova Corporation H00010160M01

Catalog No. 89-002-770


Add to cart

Description

Description

This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS
Specifications

Specifications

FARP1
2D4
Mouse monoclonal antibody raised against a partial recombinant FARP1.
FARP1
Liquid
FARP1
FARP1 (NP_005757.1, 471 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Immunofluorescence, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_005766
CDEP|MGC87400|PLEKHC2
Mouse
IgG2a Kappa
RUO
Primary
10160
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit