Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXW11 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155052

Catalog No. NBP155052


Add to cart

Description

Description

FBXW11 Polyclonal antibody specifically detects FBXW11 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

FBXW11
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
FBXW11
Synthetic peptides corresponding to FBXW11(F-box and WD repeat domain containing 11) The peptide sequence was selected from the N terminal of FBXW11. Peptide sequence CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD.
62 kDa
100 ul
Signal Transduction, Wnt Signaling Pathway
Primary
23291
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 0.2-1 ug/ml
Q9UKB1
beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only