Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Fc epsilon RI beta/MS4A2, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP231807

Catalog No. NBP231807


Add to cart

Description

Description

Fc epsilon RI beta/MS4A2 Polyclonal antibody specifically detects Fc epsilon RI beta/MS4A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Fc epsilon RI beta/MS4A2
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
MS4A2
This antibody was developed against a recombinant protein corresponding to amino acids: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Q01362
APY, ATOPY, Fc epsilon receptor I beta-chain, FCER1BIGEL, FCERI, High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain), high affinity immunoglobulin epsilon receptor subunit beta, IgE Fc receptor subunit beta, IgE responsiveness (atopic), IGER, IGHER, immunoglobulin E receptor, high affinity, beta polypeptide, Membrane-spanning 4-domains subfamily A member 2, membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide), MS4A1
Rabbit
IgG
0.1 ml
Asthma, Immunology, Signal Transduction
Primary
2206
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only