Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Fc receptor-like 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FCRL1.

Manufacturer:  Abnova Corporation H00115350A01

Catalog No. 89-004-769


Add to cart

Description

Description

This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transmembrane domain and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs. This protein may play a role in the regulation of cancer cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: ASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLET
Specifications

Specifications

Fc receptor-like 1
Unconjugated
50% glycerol
NM_052938
DKFZp667O1421|FCRH1|IFGP1|IRTA5|RP11-367J7.7
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant FCRL1.
FCRL1
Serum
FCRL1
FCRL1 (NP_443170, 23 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
115350
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit