Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGD1 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179979

Catalog No. NBP179979


Add to cart

Description

Description

FGD1 Polyclonal antibody specifically detects FGD1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

FGD1
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
FGD1
Synthetic peptide directed towards the C terminal of human FGD1. Peptide sequence WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT.
107 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Equine: 79%.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry
NP_004454
faciogenital dysplasia (Aarskog-ScRhoGEF and PH domain-containing protein 1, Faciogenital dysplasia 1 protein, FGDYMRXS16, FYVE, RhoGEF and PH domain containing 1, Rho/Rac guanine nucleotide exchange factor FGD1, ZFYVE3AAS, Zinc finger FYVE domain-containing protein 3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
2245
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only