Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGF19, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FGF19 protein.

Manufacturer:  Abnova Corporation H00009965B02P

Catalog No. 89-002-822


Add to cart

Description

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq

Sequence: MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Specifications

Specifications

FGF19
Unconjugated
In 1X PBS, pH 7.4
NM_005117
FGF19
FGF19 (NP_005108.1, 1 a.a. ~ 216 a.a) full-length human protein.
RUO
Primary
9965
Western Blot
Mouse polyclonal antibody raised against a full-length human FGF19 protein.
FGF19
Purified
Mouse
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit