Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Fibrinopeptide A, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP233613

Catalog No. NBP233613


Add to cart

Description

Description

Fibrinopeptide A Polyclonal antibody specifically detects Fibrinopeptide A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Fibrinopeptide A
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
FGA
This antibody was developed against a recombinant protein corresponding to amino acids: GHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKT
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
P02671
Fib2, fibrinogen alpha chain, fibrinogen, A alpha polypeptide, MGC119422, MGC119423, MGC119425
Rabbit
IgG
0.1 ml
Cell Cycle and Replication
Primary
2243
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only