Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Fibroblast Activation Protein alpha/FAP, Polyclonal, Novus Biologicals™

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP234128

Catalog No. NBP234128

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

Fibroblast Activation Protein alpha/FAP
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
FAP
This antibody was developed against a recombinant protein corresponding to amino acids: ERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKM
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Q12884
170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, seprase, vibronectin
Rabbit
IgG
0.1 ml
Cancer, Protein Phosphatase
Primary
2191
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only