FKBP11 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP184678

Catalog No. NBP184678

Description

FKBP11 Polyclonal antibody specifically detects FKBP11 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: FKBP11
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 19 kDa FK506-binding protein, EC 5.2.1.8, FK506 binding protein 11, 19 kDa, FK506-binding protein 11, FKBP-11, FKBP-19, FKBP19FK506 binding protein 11 (19 kDa), MGC54182,19 kDa FKBP, peptidyl-prolyl cis-trans isomerase FKBP11, PPIase FKBP11, rotamase
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of SFKBP11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Format: Affinity Purified
• Gene Symbols: FKBP11
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51303
• Target Species: Human, Mouse

For Research Use Only