Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.
Please call 1-800-766-7000 to place your order or try our site again later.
anti-FRS3, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP183420
Description
FRS3 Polyclonal antibody specifically detects FRS3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FRS3 | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FGFR substrate 3, FGFR-signaling adaptor SNT2, fibroblast growth factor receptor substrate 3, FRS2B, FRS2beta, FRS2-beta, SNT2, SNT-2MGC17167, Suc1-associated neurotrophic factor target 2, suc1-associated neurotrophic factor target 2 (FGFR signalling adaptor) | |
Rabbit | |
IgG | |
0.1 ml | |
Signal Transduction | |
Primary | |
10817 | |
Human, Rat |
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Affinity Purified | |
FRS3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT | |
Immunogen affinity purified | |
RUO | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
Polyclonal | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only