G6PD, Mouse, Clone: 3H5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant G6PD.

Manufacturer: Abnova Corporation H00002539M01

Catalog No. 89-022-245

  Check Availability
Add to Cart

    Specifications

    Antigen G6PD
    Applications Enzyme Linked Immunosorbent Assay
    Clone 3H5
    Conjugate Unlabeled
    Cross Reactivity Human
    Description glucose-6-phosphate dehydrogenase
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene G6PD
    Gene Accession No. BC000337
    Gene Alias G6PD1
    Gene Symbols G6PD
    Host Species Mouse
    Immunogen G6PD (AAH00337, 406 a.a. ∽515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26KDa.
    Isotype IgG2a, κ
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 2539

    This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic nonspherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Sequence: TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit