Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G6PD, Mouse, Clone: 3H5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant G6PD.

Manufacturer:  Abnova Corporation H00002539M01

Catalog No. 89-022-245


  Check Availability
Add to cart

Specifications

Description

This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic nonspherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL
Description & Specifications

Specifications

G6PD
3H5
Human
Liquid
G6PD
G6PD1
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA
Unlabeled
glucose-6-phosphate dehydrogenase
In 1X PBS, pH 7.4
BC000337
G6PD
G6PD (AAH00337, 406 a.a. ∽515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26KDa.
50μg
Human
Primary
2539
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit