Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GABARAPL1 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155202

Catalog No. NBP155202


Add to cart

Description

Description

GABARAPL1 Polyclonal antibody specifically detects GABARAPL1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

GABARAPL1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GABARAPL1
Synthetic peptides corresponding to GABARAPL1(GABA(A) receptor-associated protein like 1) The peptide sequence was selected from the N terminal of GABARAPL1 (NP_113600). Peptide sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL.
14 kDa
100 ul
Autophagy
Primary
23710
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1 ug/ml, Immunohistochemistry 5 ug/ml, Immunohistochemistry-Paraffin 5 ug/ml
Q9H0R8
APG8L, APG8-LIKE, ATG8, ATG8B, ATG8L, Early estrogen-regulated protein, GABA(A) receptor-associated protein like 1, gamma-aminobutyric acid receptor-associated protein-like 1, gec1, GEC-1, GEC1GABA(A) receptor-associated protein-like 1, Glandular epithelial cell protein 1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only